| Bioactivity | [Asn23]-beta-Amyloid (1-42), iowa mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Iowa mutation, where Asp 23 is replaced with Asn, is associated with severe cerebral amyloid beta-protein angiopathy (CAA). The affected individuals share a missense mutation in APP at position 694. The mutated beta-amyloid peptide aggregates more rapidly and forms toxic fibrils.) |
| Name | [Asn23]-beta-Amyloid (1-42), iowa mutation |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Shortening | DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA |
| Formula | C203H312N56O59S |
| Molar Mass | 4513.05 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
[Asn23]-beta-Amyloid (1-42), iowa mutation
CAS: F: C203H312N56O59S W: 4513.05
-beta-Amyloid (1-42), iowa mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gen
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.